PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0235s0230.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 608aa    MW: 66294.4 Da    PI: 8.0011
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0235s0230.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.52.7e-24233277145
                     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                             d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e+
  SapurV1A.0235s0230.1.p 233 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHINRGRHRSRKPVES 277
                             79****************************************986 PP

2QLQ56.86.7e-20163198237
                     QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                             +FT++Q+++L++Q+l+yKy+ a++PvP++L+ +++k
  SapurV1A.0235s0230.1.p 163 SFTPSQWMELEHQALIYKYITARVPVPSNLIIPLKK 198
                             8******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.2E-11162198IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.1E-14163196IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.187163198IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.54233277IPR014977WRC domain
PfamPF088797.8E-21234276IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
MDFGVLGLEG LVGPKTSSEA PSHVSPPETK QKILGSVSSK QERSASSAQD DYWRTSKMPK  60
NNDFSVTKTM SLHQPASLLR SNYMFSDDSL QQEHMMSFSS PRPETTPFLR RDGGFVERST  120
QNHTASSLPY YQNTASSYIR SAGYDTGALN AGMHGTFTGV RGSFTPSQWM ELEHQALIYK  180
YITARVPVPS NLIIPLKKSI YPYGLPGSST GSFPHNSLGW SAFHLVYPGN NTDPEPGRCR  240
RTDGKKWRCS RDAVADQKYC ERHINRGRHR SRKPVESQTG HAATGTASSN VLPMSNSTSK  300
LVISSGGASN GIAMTMQQQF KILQPAAANS SADADVNRAQ DARNISMMSS TINQKSDESS  360
FSVPKQDFSM EQCSQTEFGF VSSDSLLNPS QKSSYNNSKP NESFLNFNDK ESQDQHAPRH  420
FINDWPKDQS NRSVICWPEE LKSDWTQLSM SIPMASSDFS SSSSSPTHEK LALSPMRLSC  480
EFDHVQMGLR VSIDHNESSQ KQTNWIPISW GTSIGGPLGE VLTTNTSHAD SCKSSSALSL  540
LREGCDGSPQ LRSSPTGVLQ KSAFCSLSNS SSGSSPRAES KKNNDTASLY EDVLGSIIAS  600
SSPIPSL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818754e-44LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132624e-44LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002320668.10.0hypothetical protein POPTR_0014s00780g
TrEMBLB9IBM40.0B9IBM4_POPTR; Uncharacterized protein
STRINGPOPTR_0014s00780.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20853481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.11e-107growth-regulating factor 1